SARS-CoV-2 Nucleocapsid Protein (203/204: RG>KR mutant, His-tagged)

A purified, soluble, recombinant SARS-CoV-2 nucleocapsid protein, His-tagged
Technology No. 39093-2

A purified, recombinant SARS-CoV-2 nucleocapsid protein (R203K–G204R). 

This protein represents the nucleocapsid protein from the variant of the original SARS-CoV-2 strain, in which the arginine-glycine amino acids in position 203-204 have been substituted with lysine-arginine (203/204: RG>KR mutation). 

Details (see spec sheet for more details)

  • Host: E. coli
  • Tag: minimal N-terminal six-histidine tagged (HHHHHHG)
  • Purity: >95%, assessed by SDS-PAGE.
  • Formulation: Aqueous solution flash frozen at -80 °C
  • Quantities available: 1 mg, 10 mg & 100 mg. Multiples may be ordered.

For other pack sizes/larger quantities or questions regarding aliqoting please contact us.

Please select the correct licence to reflect the quantity being ordered.

Sequence

MHHHHHHGSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWF

TALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYL

GTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYA

EGSRGGSQASSRSSSRSRNSSRNSTPGSSKRTSPARMAGNGGDAALALLLLDRLNQLESK

MSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIR

QGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILL

NKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSS

ADSTQA

(Note: Amino acids 9-426 of the sequence above matches residues 2-419 of SARS-CoV-2 Nucleocapsid protein GenBank entry QIQ08827)

Background

The coronavirus nucleocapsid (N) protein has a structural role, binding to the viral RNA and forming the nucleocapsid. The N protein is highly immunogenic and abundantly expressed during infection which makes it an important marker in diagnostic assays for COVID-19. Recombinant nucleocapsid proteins are commonly used in viral quantification assays and in ELISAs for detection of human antibodies against coronavirus.

Many isolates encode this variant, for a fuller list of identical protein sequences see https://www.ncbi.nlm.nih.gov/ipg/QIQ08827.1

Ordering

Particular attention should be paid when selecting the licence.

Delivery and checkout questions

A £20 packaging charge is added at checkout to cover handling costs.

For UK orders: recipients are asked to provide details of their intended use for the material and to provide a courier code to cover delivery of material.  

For International orders: The University ships this material internationally using INCOTERMS EXW (ex-works).  The recipient is responsible for arranging delivery, insurance and payment of customs charges.

Keywords

SARS-CoV-2, nucleocapsid, protein, coronavirus, COVID, COVID-19, 2019-ncov, variant, mutant, 203-204, RG>KR, R203K, G204R, arginine-glycine, lysine-arginine

Further information

Further information on the research group may be found at:

https://www.sheffield.ac.uk/medicine/people/iicd/jon-r-sayers

https://www.sheffield.ac.uk/news/nr/sheffield-coronavirus-antibody-research-1.893554

  • swap_vertical_circlemode_editAuthors (1)
    Prof Jon Sayers
  • swap_vertical_circlelibrary_booksReferences (0)
  • swap_vertical_circlecloud_downloadDownloads (1)
    Datasheet - SARS-CoV-2 Nucleocapsid Protein (203/204: RG>KR mutant, His-tagged)
    HT-NCP_203_204_SARS-CoV-2-datasheet_1B.pdf
    size: 360 KB, type: application/pdf
    Files marked with an asterix (*) can only be downloaded by users that have the appropriate product license. The license must be active and you must be logged into your account.
Non-commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
1 mg - licence for academics and non-commercial organisations

Term: perpetual

Price per 1 unit:
£200.00 excl. VAT

Commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
1 mg - licence for commercial organisations

Term: perpetual

Price per 1 unit:
£400.00 excl. VAT

Non-commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
10 mg - licence for academics and non-commercial organisations

Term: perpetual

Price per 1 unit:
£1,800.00 excl. VAT

Commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
10 mg - licence for commercial organisations

Term: perpetual

Price per 1 unit:
£3,600.00 excl. VAT

Non-commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
100 mg - licence for academics and non-commercial organisations

Term: perpetual

Price per 1 unit:
£10,000.00 excl. VAT

Commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
100 mg - licence for commercial organisations

Term: perpetual

Price per 1 unit:
£20,000.00 excl. VAT

Questions about this technology?