SARS-CoV-2 Nucleocapsid Protein (203/204: RG>KR mutant, His-tagged)

A purified, soluble, recombinant SARS-CoV-2 nucleocapsid protein, His-tagged
Technology No. 39093-2

A purified, recombinant SARS-CoV-2 nucleocapsid protein (R203K–G204R). 

This protein represents the nucleocapsid protein from the variant of the original SARS-CoV-2 strain, in which the arginine-glycine amino acids in position 203-204 have been substituted with lysine-arginine (203/204: RG>KR mutation). 

Details (see spec sheet for more details)

  • Host: E. coli
  • Tag: minimal N-terminal six-histidine tagged (HHHHHHG)
  • Purity: >95%, assessed by SDS-PAGE.
  • Formulation: Aqueous solution flash frozen at -80 °C
  • Quantities available: 1 mg, 10 mg & 100 mg. Multiples may be ordered.

For other pack sizes/larger quantities or questions regarding aliqoting please contact us.

Please select the correct licence to reflect the quantity being ordered.

Sequence

MHHHHHHGSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWF

TALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYL

GTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYA

EGSRGGSQASSRSSSRSRNSSRNSTPGSSKRTSPARMAGNGGDAALALLLLDRLNQLESK

MSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIR

QGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILL

NKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSS

ADSTQA

(Note: Amino acids 9-426 of the sequence above matches residues 2-419 of SARS-CoV-2 Nucleocapsid protein GenBank entry QIQ08827)

Background

The coronavirus nucleocapsid (N) protein has a structural role, binding to the viral RNA and forming the nucleocapsid. The N protein is highly immunogenic and abundantly expressed during infection which makes it an important marker in diagnostic assays for COVID-19. Recombinant nucleocapsid proteins are commonly used in viral quantification assays and in ELISAs for detection of human antibodies against coronavirus.

Many isolates encode this variant, for a fuller list of identical protein sequences see https://www.ncbi.nlm.nih.gov/ipg/QIQ08827.1

Ordering

Particular attention should be paid when selecting the licence.

Delivery and checkout questions

A charge is added at checkout to cover packing and shipping costs. This will be £20 for UK orders and £50 for EU orders. The material will be packaged with dry ice and shipped by DHL.

For deliveries outside the UK or EU please enquire for shipping costs.

Recipients are asked to provide details of their intended use for the material.

For International orders: The University ships this material internationally using INCOTERMS DAP (Delivered at Place). Under these terms, the seller (Sheffield) is required to clear the goods for export and the buyer is responsible for effecting customs clearance, and paying any customs duties.

PLEASE NOTE: The customer will be contacted by the courier to clear the shipment at customs and pay any customs or import duty. Please provide the appropriate contact details, at the checkout stage, for the person responsible for making payment for customs charges and be sure to comply with courier enquiries in order to avoid shipment delays.

Keywords

SARS-CoV-2, nucleocapsid, protein, coronavirus, COVID, COVID-19, 2019-ncov, variant, mutant, 203-204, RG>KR, R203K, G204R, arginine-glycine, lysine-arginine

Further information

Further information on the research group may be found at:

https://www.sheffield.ac.uk/medicine/people/iicd/jon-r-sayers

https://www.sheffield.ac.uk/news/nr/sheffield-coronavirus-antibody-research-1.893554

  • expand_more mode_edit Authors (1)
    Prof Jon Sayers
  • expand_more cloud_download Supporting documents (2)
    Product brochure
    SARS-CoV-2 Nucleocapsid Protein (203/204: RG>KR mutant, His-tagged).pdf
    Datasheet - SARS-CoV-2 Nucleocapsid Protein (203/204: RG>KR mutant, His-tagged)
    HT-NCP_203_204_SARS-CoV-2-datasheet_1B.pdf (360 KB)
    Additional files may be available once you've completed the transaction for this product. If you've already done so, please log into your account and visit My account / Downloads section to view them.
Non-commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
1 mg - licence for academics and non-commercial organisations

Term: perpetual

Price per unit:
From £200.00 excl. VAT

Commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
1 mg - licence for commercial organisations

Term: perpetual

Price per unit:
From £400.00 excl. VAT

Non-commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
10 mg - licence for academics and non-commercial organisations

Term: perpetual

Price per unit:
From £1,800.00 excl. VAT

Commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
10 mg - licence for commercial organisations

Term: perpetual

Price per unit:
From £3,600.00 excl. VAT

Non-commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
100 mg - licence for academics and non-commercial organisations

Term: perpetual

Price per unit:
From £10,000.00 excl. VAT

Commercial use licence - SARS-CoV-2 Protein (203/204: RG>KR mutant, His-tagged)
100 mg - licence for commercial organisations

Term: perpetual

Price per unit:
From £20,000.00 excl. VAT

Questions about this technology?