SARS-CoV-2 Nucleocapsid Protein (His-tagged)
A purified, soluble recombinant SARS-CoV-2 nucleocapsid protein, His-tagged




A Purified, recombinant SARS-CoV-2 nucleocapsid protein.
Details (see spec sheet for more details)
Host: E. coli
Tag: minimal N-terminal six-histidine tagged (HHHHHHG)
Purity: <95%, assessed by SDS-PAGE.
Formulation: Aqueous solution flash frozen at -80 °C
Quantities available: 1 mg, 10 mg & 100 mg. Multiples may be ordered.
For other pack sizes/larger quantities or questions regarding aliqoting please contact us.
Please select the correct licence to reflect the quantity being ordered.
Sequence
MHHHHHHGSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWF
TALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYL
GTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYA
EGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESK
MSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIR
QGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILL
NKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSS
ADSTQA
(Note: N-terminal Met is removed on processing in E. coli, so that amino acids 9-426 of the sequence above matches residues 2-419 of SARS-CoV-2 Nucleocapsid protein GenBank entry QHD43423.2.)
Background
The coronavirus nucleocapsid (N) protein has a structural role, binding to the viral RNA and forming the nucleocapsid. The N protein is highly immunogenic and abundantly expressed during infection which makes it an important marker in diagnostic assays for COVID-19. Recombinant nucleocapsid proteins are commonly used in viral quantification assays and in ELISAs for detection of human antibodies against coronavirus.
Ordering
Particular attention should be paid when selecting the licence.
Delivery and checkout questions
A £20 packaging charge is added at checkout to cover handling costs.
For UK orders: recipients are asked to provide details of their intended use for the material and to provide a courier code to cover delivery of material.
For International orders: The University ships this material internationally using INCOTERMS EXW (ex-works). The recipient is responsible for arranging delivery, insurance and payment of customs charges.
Keywords
SARS-CoV-2, nucleocapsid, protein, coronavirus, COVID, COVID-19, 2019-ncov
Further information
Further information on the research group may be found at:
https://www.sheffield.ac.uk/medicine/people/iicd/jon-r-sayers
https://www.sheffield.ac.uk/news/nr/sheffield-coronavirus-antibody-research-1.893554
-
swap_vertical_circlemode_editAuthors (1)Prof Jon Sayers
-
swap_vertical_circlelibrary_booksReferences (0)
-
swap_vertical_circlecloud_downloadDownloads (3)Tagged datasheetHT-NCAP_SARS-CoV-2-datasheet_B2.1.pdfsize: 1 MB, type: application/pdfSequence - SARS-COV-2 Nucleocapsid protein His TaggedSARS-COV-2 Nucleocapsid protein His Tagged sequence.pdfsize: 76 KB, type: application/pdfHT-NCAP_SARS-CoV-2-datasheet_lot2.pdfsize: 4 MB, type: application/pdfFiles marked with an asterix (*) can only be downloaded by users that have the appropriate product license. The license must be active and you must be logged into your account.