SARS-CoV-2 Nucleocapsid Protein (Native/Non-tagged)

A purified, soluble recombinant SARS-CoV-2 nucleocapsid protein
Technology No. 39093-1

SARS-CoV-2 Nucleocapsid Protein (Native/Non-tagged)

A purified, soluble recombinant SARS-CoV-2 nucleocapsid protein.

Product Details (see spec sheet for more details)

Host: E. coli

Tag: None

Purity: <95%, assessed by SDS-PAGE.

Formulation: Aqueous solution flash frozen at -80 °C

Quantities available: 1 mg, 10 mg & 100 mg.  Multiples may be ordered.

For other pack sizes/larger quantities or questions regarding aliquoting please contact us.

Please select the correct licence to reflect the quantity being ordered.

Sequence

MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG

KEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG

LPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS

QASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ

QQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH

WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY

KTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

(Note: N-terminal Met is removed on processing in E. coli, so the product matches residues 2-419 of SARS-CoV-2 GenBank entry QHD43423.2.)

Background

The coronavirus nucleocapsid (N) protein has a structural role, binding to the viral RNA and forming the nucleocapsid. The N protein is highly immunogenic and abundantly expressed during infection which makes it an important marker in diagnostic assays for COVID-19. Recombinant nucleocapsid proteins are commonly used in viral quantification assays and in ELISAs for detection of human antibodies against coronavirus. 

Keywords

SARS-CoV-2, nucleocapsid, protein, coronavirus, COVID, COVID-19, 2019-ncov

Ordering

Particular attention should be paid when selecting the licence.

Delivery and checkout questions

A £20 packaging charge is added at checkout to cover handling costs.

For UK orders: recipients are asked to provide details of their intended use for the material and to provide a courier code to cover delivery of material. 

For International orders: The University ships this material internationally using INCOTERMS EXW (ex-works). The recipient is responsible for arranging delivery, insurance and payment of customs charges. Further information

Further information on the research group may be found at:

 https://www.sheffield.ac.uk/medicine/people/iicd/jon-r-sayers

https://www.sheffield.ac.uk/news/nr/sheffield-coronavirus-antibody-research-1.893554



  • swap_vertical_circlemode_editAuthors (1)
    Prof Jon Sayers
  • swap_vertical_circlelibrary_booksReferences (0)
  • swap_vertical_circlecloud_downloadDownloads (2)
    Native SARS-CoV-2 Datasheet Lot4
    Native_NCAP_SARS-CoV-2-datasheet_lot4.pdf
    size: 1 MB, type: application/pdf
    Sequence - SARS-COV-2 Nucleocapsid protein Native
    SARS-COV-2 Nucleocapsid protein Native Sequence.pdf
    size: 27 KB, type: application/pdf
    Files marked with an asterix (*) can only be downloaded by users that have the appropriate product license. The license must be active and you must be logged into your account.
Non-commercial use licence - SARS-CoV-2 Protein (Native)
1 mg - licence for academics and non-commercial organisations

Term: perpetual

Price per 1 unit:
£220.00 excl. VAT

Commercial use licence - SARS-CoV-2 Protein (Native)
1 mg - licence for commercial organisations

Term: perpetual

Price per 1 unit:
£440.00 excl. VAT

Non-commercial use licence - SARS-CoV-2 Protein (Native)
10 mg - licence for academics and non-commercial organisations

Term: perpetual

Price per 1 unit:
£1,980.00 excl. VAT

Commercial use licence - SARS-CoV-2 Protein (Native)
10 mg - licence for commercial organisations

Term: perpetual

Price per 1 unit:
£3,960.00 excl. VAT

Non-commercial use licence - SARS-CoV-2 Protein (Native)
100 mg - licence for academics and non-commercial organisations

Term: perpetual

Price per 1 unit:
£11,000.00 excl. VAT

Commercial use licence - SARS-CoV-2 Protein (Native)
100 mg - licence for commercial organisations

Term: perpetual

Price per 1 unit:
£22,000.00 excl. VAT

Questions about this technology?